Antibodies

View as table Download

IL17B (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 46-74aa) of human Interleukin-17B / IL17B

IL17B rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98%) E.coli derived recombinant Human IL-17 beta (Cat.-No PA283)

IL17B rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (> 98%) E.coli derived recombinant Human IL-17 beta (Cat.-No PA283)

IL17B rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL17B

IL17B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL17B

IL-17B Rabbit polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide from human protein at AA range: 1-50

Rabbit Polyclonal Anti-Il17b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Il17b antibody is: synthetic peptide directed towards the N-terminal region of Rat Il17b. Synthetic peptide located within the following region: LLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARM

IL17B rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (> 98%) E.coli derived 36.6 kDa recombinant human IL-17B

IL17B rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (> 98%) E.coli derived 36.6 kDa recombinant human IL-17B