Antibodies

View as table Download

E2F1 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human E2F1

Rabbit Polyclonal E2F1 Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

E2F1 (acetyl K120/K125) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from internal domain of Human E2F-1 protein containing acetyl lysine 120 and 125

Rabbit polyclonal E2F-1 phospho S364 antibody

Applications IHC, WB
Reactivities Human, Chimpanzee
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 360-369 of Human E2F-1.

E2F1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 400-450 of Human E2F-1.

E2F1 pSer337 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S337 of human E2F1.

E2F1 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human E2F1
Modifications Unmodified

E2F1 (acetyl K120/K125) rabbit polyclonal antibody, Serum

Applications ELISA, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from internal domain of human E2F-1 protein containing acetyl lysine 120 and 125

Rabbit Polyclonal E2F1 (Thr433) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human E2F1 around the phosphorylation site of Threonine 433
Modifications Phospho-specific

Rabbit Polyclonal E2F1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human E2F1

Rabbit Polyclonal Anti-E2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the N terminal of human E2F1. Synthetic peptide located within the following region: PARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWA

E2F1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide corresponding to amino acid residues surrounding S332 of human E2F1.

E2F1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide corresponding to amino acid residues surrounding H357 of human E2F1.

Rabbit Polyclonal Anti-E2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the C terminal of human E2F1. Synthetic peptide located within the following region: REDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF

Rabbit Polyclonal Anti-E2F-1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F-1 Antibody: Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1