IL5 Rabbit monoclonal antibody,clone OTIR1G2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL5 Rabbit monoclonal antibody,clone OTIR1G2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL5 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 61-110 of Human IL-5 |
IL5 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-5 (Cat.-No PA078) |
IL5 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure (>98%) E.coli derived recombinant Human IL-5 (Cat.-No PA078) |
Recombinant Anti-IL-5 (Clone 2E3)
Applications | ELISA, Neutralize |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Rabbit Polyclonal Anti-Interleukin 5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5 |
IL5 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) E.coli derived recombinant hIL-5 (human IL-5). |
IL5 rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (>98%) E.coli derived recombinant hIL-5 (human IL-5). |
Anti-IL5 antibody(DMC274), IgG1 Chimeric mAb
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
IL5 Rabbit monoclonal antibody,clone OTIR1G2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |