Antibodies

View as table Download

Rabbit Polyclonal Anti-PIKFYV Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PIKFYV

Rabbit polyclonal PLCG1 (Ab-771) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A).

Anti-PTEN rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 381-396 amino acids of human phosphatase and tensin homolog

Rabbit polyclonal PI3KC3 Antibody (S34)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Pig, Xenopus)
Conjugation Unconjugated
Immunogen This PI3KC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 14-39 amino acids from human PI3KC3.

Rabbit polyclonal PI3KCD Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 687-717 amino acids from the C-terminal region of human PI3KCD.

Rabbit polyclonal PI3KCD Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This PI3KCD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-114 amino acids from the N-terminal region of human PI3KCD.

Rabbit polyclonal PLCB2 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLCB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-202 amino acids from the N-terminal region of human PLCB2.

Rabbit Polyclonal Anti-INPP5K Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-INPP5K antibody: synthetic peptide directed towards the C terminal of human INPP5K. Synthetic peptide located within the following region: PPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHF

Rabbit Polyclonal antibody to ITPK1 (inositol 1,3,4-triphosphate 5/6 kinase)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 171 and 414 of ITPK1 (Uniprot ID#Q13572)

Rabbit Polyclonal Anti-IPMK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IPMK antibody is: synthetic peptide directed towards the middle region of Human IPMK. Synthetic peptide located within the following region: SDSYETENQHYGRSLTKETIKDGVSRFFHNGYCLRKDAVAASIQKIEKIL

Rabbit Polyclonal antibody to INPP5B (inositol polyphosphate-5-phosphatase, 75kDa)

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 699 and 949 of INPP5B (Uniprot ID#P32019)

Rabbit polyclonal PTEN (Ab-370) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370.

Rabbit polyclonal anti-IPPK antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IPPK.

Rabbit polyclonal PIK3CG antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIK3CG.

PLCG2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PLCG2