Anti-HNF1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A |
Anti-HNF1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A |
Anti-HNF1A Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A |
Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Rabbit Polyclonal Anti-HNF1A
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
Rabbit polyclonal antibody to HNF-1 alpha (HNF1 homeobox A)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Pig, Rat, Bovine, X. tropicalis) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 35 and 268 of HNF1 alpha (Uniprot ID#P20823) |
Rabbit polyclonal HNF1A Antibody (Center)
Applications | IF, WB |
Reactivities | Human, Mouse (Predicted: Rat) |
Conjugation | Unconjugated |
Immunogen | This HNF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 177-205 amino acids from the Central region of human HNF1A. |
Anti-HNF1A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 57-70 amino acids of human HNF1 homeobox A |
Rabbit Polyclonal anti-HNF1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HNF1A antibody is: synthetic peptide directed towards the C-terminal region of Human HNF1A. Synthetic peptide located within the following region: QTMLITDTTNLSALASLTPTKQVFTSDTEASSESGLHTPASQATTLHVPS |
HNF1A Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HNF1A |