Rabbit polyclonal anti-ZFYVE19 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZFYVE19. |
Rabbit polyclonal anti-ZFYVE19 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ZFYVE19. |
ZFYVE19 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 386-415 amino acids from the C-terminal region of human ZFYVE19 |
Rabbit Polyclonal Anti-ZFYVE19 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZFYVE19 antibody: synthetic peptide directed towards the C terminal of human ZFYVE19. Synthetic peptide located within the following region: CNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH |