ZFYVE19 Rabbit Polyclonal Antibody

CAT#: TA339668

Rabbit Polyclonal Anti-ZFYVE19 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of zinc finger, FYVE domain containing 19 (ZFYVE19)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human zinc finger, FYVE domain containing 19 (ZFYVE19), 20 µg
    • 20 ug

USD 867.00

Other products for "ZFYVE19"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZFYVE19 antibody: synthetic peptide directed towards the C terminal of human ZFYVE19. Synthetic peptide located within the following region: CNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name zinc finger FYVE-type containing 19
Background ZFYVE19 contains 1 FYVE-type zinc finger. A chromosomal aberration, translocation t(11;15)(q23;q14) with MLL/HRX, involving ZFYVE19 is associated with acute myeloblastic leukemia (AML).
Synonyms ANCHR; MPFYVE
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 79%; Guinea pig: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.