ZFYVE19 Rabbit Polyclonal Antibody
USD 665.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZFYVE19 antibody: synthetic peptide directed towards the C terminal of human ZFYVE19. Synthetic peptide located within the following region: CNEDATLRCAGCDGDLFCARCFREGHDAFELKEHQTSAYSPPRAGQEH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 51 kDa |
Gene Name | zinc finger FYVE-type containing 19 |
Database Link | |
Background | ZFYVE19 contains 1 FYVE-type zinc finger. A chromosomal aberration, translocation t(11;15)(q23;q14) with MLL/HRX, involving ZFYVE19 is associated with acute myeloblastic leukemia (AML). |
Synonyms | ANCHR; MPFYVE |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review