Antibodies

View as table Download

Anti-PDX1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 18-31 amino acids of human pancreatic and duodenal homeobox 1

Rabbit polyclonal FOXA2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat)
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2.

Rabbit polyclonal FOXA2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Rat (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2.

Anti-FOXA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 311-325 amino acids of Human forkhead box A2

Rabbit Polyclonal Anti-PDX1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDX1 antibody: synthetic peptide directed towards the N terminal of human PDX1. Synthetic peptide located within the following region: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPF

Rabbit anti-PDX1 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human PDX1

Rabbit Polyclonal Anti-Foxa2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Foxa2 antibody: synthetic peptide directed towards the middle region of mouse Foxa2. Synthetic peptide located within the following region: SSGGKKTAPGSQASQAQLGEAAGSASETPAGTESPHSSASPCQEHKRGGL