Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Human, Rat, Dog, Zebrafish, Bovine, Pig, Rabbit, Mouse, Guinea Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Anti-RBPMS Antibody
| Applications | FC, ICC, IHC, WB |
| Reactivities | Feline, Guinea Pig, Pig, Human, Mouse, Rabbit, Rat, Tree Shrew, Whale, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region of rat RBPMS, conjugated to keyhole limpet hemocyanin (KLH). |
GFAP rabbit polyclonal antibody, Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified Human GFAP. |
PPAR gamma (PPARG) (Isoform 1) rabbit polyclonal antibody, Purified
| Applications | ELISA |
| Reactivities | Canine, Guinea Pig, Hamster, Human, Mink, Monkey, Mouse, Rabbit, Rat, Duck |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acids 255 - 268 of human PPAR gamma isoform 1. |
GJA1 pSer368 rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide corresponding to an amino acid sequence within connexin43 which includes phosphorylated Ser368 |
Germany
Japan
United Kingdom
China