Antibodies

Jump to Filters
View as table Download
CIB1 Rabbit Polyclonal Antibody
TA374802

USD 365.00

3 Weeks

CIB1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human CIB1 (NP_006375.2).
Modifications Unmodified
Cib1 Rabbit Polyclonal Antibody
TA346609

USD 539.00

5 Days

Rabbit Polyclonal Anti-Cib1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cib1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Cib1. Synthetic peptide located within the following region: GGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHT