Cib1 Rabbit Polyclonal Antibody

CAT#: TA346609

Rabbit Polyclonal Anti-Cib1 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "Cib1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Cib1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Cib1. Synthetic peptide located within the following region: GGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 21 kDa
Gene Name calcium and integrin binding 1
Background interacts with both Fnk and Snk kinases [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: AF136585.1, BC091143.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS160522, ERS160537 [ECO:0000350] ##Evidence-Data-END##
Synonyms CALMYRIN; CIB; CIBP; KIP; KIP1; PRKDCIP; SIP2-28
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.