NDUFB10 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
NDUFB10 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-NDUFB10 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFB10. |
Rabbit polyclonal NDUFB10 Antibody (Center)
Applications | WB |
Reactivities | Human (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This NDUFB10 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 43-70 amino acids from the Central region of human NDUFB10. |
Rabbit Polyclonal Anti-NDUFB10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDUFB10 antibody is: synthetic peptide directed towards the C-terminal region of NDUFB10. Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL |