NDUFB10 Rabbit Polyclonal Antibody

CAT#: TA343253

Rabbit Polyclonal Anti-NDUFB10 Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa (NDUFB10)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "NDUFB10"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NDUFB10 antibody is: synthetic peptide directed towards the C-terminal region of NDUFB10. Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 19 kDa
Gene Name NADH:ubiquinone oxidoreductase subunit B10
Background NDUFB10 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Synonyms PDSW
Note Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Guinea pig: 93%; Dog: 79%; Horse: 79%; Zebrafish: 79%
Reference Data
Protein Pathways Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.