Antibodies

View as table Download

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IHC, IP, R, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

PPP4C Rabbit Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP4C

Rabbit polyclonal Anti-SET Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT

Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Acid Phosphatase isolated and purified from Human seminal plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.

PP1C gamma (PPP1CC) rabbit polyclonal antibody, Purified

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A KLH conjugated peptide corresponding to the C-terminal region (311-323) of PP1 gamma 1 catalytic subunit.