Anti-SHH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog |
Anti-SHH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog |
Anti-SHH Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 448-462 amino acids of Human sonic hedgehog |
Rabbit Polyclonal Sonic Hedgehog/Shh Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465] |
Rabbit Polyclonal Anti-SHH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Chicken |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT |
Sonic Hedgehog (SHH) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence near the N-terminal of human SHH |