Antibodies

Jump to Filters
View as table Download
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA334652

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
PTP1B (PTPN1) Rabbit Polyclonal Antibody
TA590672

USD 482.00

In Stock

Rabbit Polyclonal PTPN1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. In vivo generated recombinant protein fragment
GLUT4 (SLC2A4) Rabbit Polyclonal Antibody
TA323293

USD 380.00

In Stock

Anti-SLC2A4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4
GLUT4 (SLC2A4) Rabbit Polyclonal Antibody
TA323292

USD 380.00

4 Weeks

Anti-SLC2A4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 496-509 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 4