Primary Antibodies

View as table Download

Mouse Monoclonal GAPDH/G3PDH Antibody (13H12)

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Drosophila, Primate
Conjugation Unconjugated

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)

GAPDH (9-323) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Bovine, Canine, Drosophila, Feline, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Recombinant protein fragment corresponding to a region within amino acids 9 and 323 of GAPDH

Rabbit Polyclonal GAPDH/G3PDH Antibody

Applications ICC/IF, IHC, Immunoblotting, Simple Western, WB
Reactivities Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa
Conjugation Unconjugated
Immunogen Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen.

Rabbit Polyclonal Anti-TPI1 Antibody

Applications WB
Reactivities Human, Drosophila
Conjugation Unconjugated
Immunogen The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID