Mouse Monoclonal GAPDH/G3PDH Antibody (13H12)
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila, Primate |
Conjugation | Unconjugated |
Mouse Monoclonal GAPDH/G3PDH Antibody (13H12)
Applications | ICC/IF, IHC, Simple Western, WB |
Reactivities | Human, Mouse, Drosophila, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Feline, Chicken, Dog, Drosophila, Monkey, Pig, Rabbit, Xenopus, Zebrafish, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
GAPDH (9-323) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Canine, Drosophila, Feline, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment corresponding to a region within amino acids 9 and 323 of GAPDH |
Rabbit Polyclonal GAPDH/G3PDH Antibody
Applications | ICC/IF, IHC, Immunoblotting, Simple Western, WB |
Reactivities | Human, Mouse, Rat, Drosophila, Feline, Porcine, Protozoa |
Conjugation | Unconjugated |
Immunogen | Amino acids 73-87 PITIFQERDPSKIKW of glyceraldehyde 3-phosphate dehydrogenase protein were used as the immunogen. |
Rabbit Polyclonal Anti-TPI1 Antibody
Applications | WB |
Reactivities | Human, Drosophila |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TPI1 antibody: synthetic peptide directed towards the N terminal of human TPI1. Synthetic peptide located within the following region: MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID |