Primary Antibodies

View as table Download

GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated

Applications IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Biotin

GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated

Applications IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation HRP

GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)

Applications IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated

GALE (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human GALE

Rabbit Polyclonal Anti-GALE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALE antibody: synthetic peptide directed towards the N terminal of human GALE. Synthetic peptide located within the following region: AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR

Rabbit Polyclonal Anti-GALE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALE antibody: synthetic peptide directed towards the middle region of human GALE. Synthetic peptide located within the following region: PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG