GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Biotin |
GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | HRP |
GALE mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
Applications | IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
GALE (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human GALE |
Rabbit Polyclonal Anti-GALE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALE antibody: synthetic peptide directed towards the N terminal of human GALE. Synthetic peptide located within the following region: AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR |
Rabbit Polyclonal Anti-GALE Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALE antibody: synthetic peptide directed towards the middle region of human GALE. Synthetic peptide located within the following region: PQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKG |