Rabbit Polyclonal ZBP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ZBP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human ZBP1. |
Rabbit Polyclonal ZBP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ZBP1 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human ZBP1. |
Rabbit Polyclonal Anti-ZBP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ZBP1 antibody: synthetic peptide directed towards the middle region of human ZBP1. Synthetic peptide located within the following region: LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG |