Primary Antibodies

View as table Download

Factor XI (F11) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 281-307 amino acids from the Central region of human F11.

Rabbit Polyclonal antibody to Factor XI (coagulation factor XI)

Applications IHC, WB
Reactivities Human (Predicted: Dog, Rabbit)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 312 of Factor XI (Uniprot ID#P03951)

Rabbit Polyclonal Anti-F11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F11 antibody: synthetic peptide directed towards the C terminal of human F11. Synthetic peptide located within the following region: RHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFG