Factor XI (F11) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 281-307 amino acids from the Central region of human F11. |
Factor XI (F11) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 281-307 amino acids from the Central region of human F11. |
Rabbit Polyclonal antibody to Factor XI (coagulation factor XI)
Applications | IHC, WB |
Reactivities | Human (Predicted: Dog, Rabbit) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 312 of Factor XI (Uniprot ID#P03951) |
Rabbit Polyclonal Anti-F11 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F11 antibody: synthetic peptide directed towards the C terminal of human F11. Synthetic peptide located within the following region: RHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFG |