Rabbit anti-SH3GL2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SH3GL2 |
Rabbit anti-SH3GL2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SH3GL2 |
Rabbit polyclonal Anti-SH3GL2 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SH3GL2 antibody: synthetic peptide directed towards the N terminal of human SH3GL2. Synthetic peptide located within the following region: INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA |
Rabbit polyclonal Anti-SH3GL2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SH3GL2 antibody: synthetic peptide directed towards the middle region of human SH3GL2. Synthetic peptide located within the following region: PRREYQPKPRMSLEFPTGDSTQPNGGLSHTGTPKPSGVQMDQPCCRALYD |