SH3GL2 Rabbit Polyclonal Antibody

CAT#: TA342207

Rabbit polyclonal Anti-SH3GL2 Antibody

Product Images

WB Suggested Anti-SH3GL2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SH3GL2 antibody: synthetic peptide directed towards the N terminal of human SH3GL2. Synthetic peptide located within the following region: INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: SH3 domain containing GRB2 like 2, endophilin A1
• Database Link:
  NP_003017
  Entrez Gene 116743 RatEntrez Gene 6456 Human
  UniProt ID Q99962
• Background: Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature.
• Synonyms: CNSA2; EEN-B1; SH3D2A; SH3P4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Pathways: Endocytosis