Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GABRG2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GABRG2

Rabbit Polyclonal Anti-GABRG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GABRG2 antibody is: synthetic peptide directed towards the N-terminal region of Human GABRG2. Synthetic peptide located within the following region: VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINME

GABA A Receptor gamma 2 (GABRG2) (400-410) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_944494.1; NP_000807.2; NP_944493.2.

Rabbit Polyclonal Anti-GABRG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the N terminal of human GABRG2. Synthetic peptide located within the following region: GFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDI

Rabbit Polyclonal Anti-GABRG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the C terminal of human GABRG2. Synthetic peptide located within the following region: AMDLFVSVCFIFVFSALVEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIR