Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
Rabbit anti-PDGFC polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | peptide coupled to KLH |
Rabbit anti-PDGFC polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Partial recombaint protein |
Pro-EGF Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Internal region (near the N terminus) (SRQERVCNIEKNVS) |
Rabbit Polyclonal Anti-PDGFC Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFC antibody is: synthetic peptide directed towards the C-terminal region of Human PDGFC. Synthetic peptide located within the following region: CTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPS |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
PDGFC Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFC |
PDGFC Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PDGFC |
EGF mouse monoclonal antibody,clone OTI8E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EGF rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hEGF (human EGF). |
EGF rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hEGF (human EGF). |
Active filters
Reactivities
- Human
Families
- Induced pluripotent stem cells
Pathways
- Gap junction