Primary Antibodies

View as table Download

Anti-EGF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

EGF (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 689-720 amino acids from the Central region of human EGF

EGF mouse monoclonal antibody, clone KT2, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

EGF mouse monoclonal antibody, clone S-147, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY

Pro-EGF Goat Polyclonal Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Internal region (near the N terminus) (SRQERVCNIEKNVS)

Rabbit Polyclonal Anti-EGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF

EGF mouse monoclonal antibody,clone OTI8E2

Applications WB
Reactivities Human
Conjugation Unconjugated

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).

EGF rabbit polyclonal antibody, Biotin

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant hEGF (human EGF).

EGF mouse monoclonal antibody, clone S-120, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

EGF mouse monoclonal antibody, clone S-145, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated

EGF mouse monoclonal antibody, clone S-146, Biotin

Applications ELISA
Reactivities Human
Conjugation Biotin

EGF mouse monoclonal antibody, clone S-146, HRP

Applications ELISA
Reactivities Human
Conjugation HRP

EGF mouse monoclonal antibody, clone S-177, Aff - Purified

Applications ELISA
Reactivities Human
Conjugation Unconjugated