Rabbit polyclonal anti-PIPOX antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIPOX. |
Rabbit polyclonal anti-PIPOX antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIPOX. |
Rabbit Polyclonal Anti-PIPOX Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIPOX antibody: synthetic peptide directed towards the C terminal of human PIPOX. Synthetic peptide located within the following region: FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG |