Germany
Japan
United Kingdom
China
USD 580.00
2 Weeks
Aspartate Aminotransferase (GOT1) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GOT1 |
Primary Antibodies
View as table Download
HPD (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human HPD |
AOC2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Human, Mouse, Rat, Zebrafish, African clawed frog |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human AOC2 |
Goat Polyclonal Antibody against GOT1
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TADFREDPDPRKVN, from the internal region of the protein sequence according to NP_002070.1. |
Goat Polyclonal Antibody against GOT2
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNLKKEGSTHNWQH, from the internal region of the protein sequence according to NP_002071.2. |
Goat Polyclonal Antibody against GOT2 (Internal Region)
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CKDADEAKRVES, from the internal region of the protein sequence according to NP_002071.2. |
Rabbit Polyclonal Aldh3A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1. |
Goat Anti-ALDH3B1 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QDLHKSAFESEVSE, from the internal region of the protein sequence according to NP_000685.1. |
GOT2 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | internal region (QGYRYYDPKTCGFD) |
Rabbit anti-AOC3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AOC3 |
Rabbit polyclonal Anti-MAOA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAOA antibody: synthetic peptide directed towards the middle region of human MAOA. Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE |
TAT mouse monoclonal antibody,clone OTI3G6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Mouse
Pathways
- Phenylalanine metabolism