Primary Antibodies

Jump to Filters
View as table Download
ABCA1 Mouse Monoclonal Antibody [Clone ID: AB.H10]
TA309942

USD 380.00

2 Weeks

Mouse anti-ABCA1 monoclonal antibody

Applications WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
ABCA1 Rabbit Polyclonal Antibody
TA310028

USD 285.00

3 Weeks

Rabbit anti-ABCA1 polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCA1.
ABCA1 Rabbit Polyclonal Antibody
TA332061

USD 539.00

5 Days

Rabbit Polyclonal Anti-Abca1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NRRAFGDKQSCLHPFTEDDAVDPNDSDIDPESRETDLLSGMDGKGSYQLK