Rabbit polyclonal antibody to Factor VII (coagulation factor VII (serum prothrombin conversion accelerator))
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 209 and 466 of Factor VII (Uniprot ID#P08709) |
Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AD-1, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Rabbit Polyclonal Anti-F7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F7 antibody: synthetic peptide directed towards the C terminal of human F7. Synthetic peptide located within the following region: AAHCFDKIKNWRNLIAVLGEHDLSEHDGDEQSRRVAQVIIPSTYVPGTTN |
Rabbit Polyclonal Anti-F7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F7 antibody: synthetic peptide directed towards the middle region of human F7. Synthetic peptide located within the following region: RCHEGYSLLADGVSCTPTVEYPCGKIPILEKRNASKPQGRIVGGKVCPKG |
Factor VII (F7) mouse monoclonal antibody, clone RFFVII/2, Aff - Purified
| Applications | ELISA, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 595.00
2 Weeks
Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone CaFVII-22, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 735.00
2 Weeks
Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone CaFVII-22, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AA-3, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Factor VII (F7) (+VIIa) mouse monoclonal antibody, clone AD-1, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
