BLNK (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This BLNK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the Center region of human BLNK. |
Goat Polyclonal Antibody against BLNK
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KDSTRLKYAVKVS, from the C Terminus of the protein sequence according to NP_037446.1. |
Rabbit Polyclonal Anti-BLNK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BLNK antibody: synthetic peptide directed towards the middle region of human BLNK. Synthetic peptide located within the following region: QYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKV |
Germany
Japan
United Kingdom
China