Rabbit polyclonal anti-SGCA antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SGCA. |
Rabbit polyclonal anti-SGCA antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SGCA. |
Rabbit Polyclonal N Cadherin Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4. |
Rabbit polyclonal Anti-Ryanodine Receptor 2
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CAGESMSPGQGRNN, corresponding to amino acid residues 1489-1502 of human Ryanodine Receptor 2. Intracellular, N-terminus. |
Rabbit polyclonal antibody to Desmoglein-2 (desmoglein 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of Desmoglein 2 (Uniprot ID#Q14126) |
Rabbit polyclonal CACNG6 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse) |
Conjugation | Unconjugated |
Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
CD51 (ITGAV) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ITGAV antibody was raised against synthetic peptide |
Rabbit Polyclonal Emerin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Emerin antibody was raised against a 19 amino acid peptide from near the amino terminus of human Emerin. |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Chicken) |
Conjugation | Unconjugated |
Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Integrin alpha 5 (ITGA5) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 574-602 amino acids from the Central region of Human CD49e / ITGA5 |
Goat Anti-CACNA1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5. |
Rabbit Polyclonal Anti-ITGAV Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ITGAV antibody is: synthetic peptide directed towards the C-terminal region of Human ITGAV. Synthetic peptide located within the following region: PVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENG |
ATP2A2 Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ATP2A2 |
DSG2 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human DSG2 |
beta Sarcoglycan (SGCB) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |