Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 200.00
2 Days
USD 200.00
2 Days
Rabbit polyclonal CYP2D6 Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Rat) |
| Conjugation | Unconjugated |
| Immunogen | This CYP2D6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 76-105 amino acids from the N-terminal region of human CYP2D6. |
Rabbit Polyclonal Anti-POR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POR antibody: synthetic peptide directed towards the N terminal of human POR. Synthetic peptide located within the following region: IDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT |
Rabbit Polyclonal Anti-POR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POR antibody: synthetic peptide directed towards the middle region of human POR. Synthetic peptide located within the following region: VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE |
Rabbit Polyclonal Anti-CYP1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV |
Rabbit Polyclonal Anti-CYP2D6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the N terminal of human CYP2D6. Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE |
Rabbit Polyclonal Anti-CYP4F3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Active filters
Applications
- IHC
Families
- P450
Filter by
Category
Target Symbol
- CYTOCHROME P450 REDUCTASE (47)
- CYTOCHROME P450 1A2 (41)
- TBXAS1 (28)
- CYTOCHROME P450 2A6 (25)
- CYTOCHROME P450 2E1 (20)
- CYTOCHROME P450 2J2 (17)
- CYTOCHROME P450 2C9 (16)
- CYP7B1 (7)
- CYTOCHROME P450 17A1 (7)
- CYTOCHROME P450 2B6 (7)
- AROMATASE (6)
- CYTOCHROME P450 3A4 (4)
- CYP11A1 (3)
- CYP1A1 (3)
- CYTOCHROME P450 26B (3)
- CYTOCHROME P450 2D6 (3)
- CYP11B1 (2)
- CYP21A2 (2)
- CYP27A1 (2)
- CYP2S1 (2)
- CYP2W1 (2)
- CYP39A1 (2)
- CYP46 (2)
- CYP8B1 (2)
- CYTOCHROME P450 2C8 (2)
- CYP1B1 (1)
- CYP27B1 (1)
- CYP2A7 (1)
- CYP2R1 (1)
- CYP4A22 (1)
- CYP4B1 (1)
- CYP4F2 (1)
- CYP4F3 (1)
- CYP4X1 (1)
- CYP4Z1 (1)
- CYTOCHROME P450 3A5 (1)
- CYTOCHROME P450 4A (1)
- PTGIS (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Modifications
Assay Types
Pathways
- Metabolic pathways (192)
- Drug metabolism - cytochrome P450 (120)
- Retinol metabolism (105)
- Linoleic acid metabolism (101)
- Metabolism of xenobiotics by cytochrome P450 (97)
- Arachidonic acid metabolism (95)
- Caffeine metabolism (67)
- Tryptophan metabolism (45)
- Drug metabolism - other enzymes (31)
- Primary bile acid biosynthesis (15)
- C21-Steroid hormone metabolism (14)
- Androgen and estrogen metabolism (8)
- PPAR signaling pathway (6)
- Fatty acid metabolism (2)
- Vascular smooth muscle contraction (2)
- Steroid biosynthesis (1)