Rabbit Polyclonal Anti-ADH1B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
CYP2A13 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 306-360 of Human CYP2A13. |
USD 200.00
2 Days
Cytochrome P450 3A4 (CYP3A4) (+ CYP3A5) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 351-400 of Human CYP3A4. |
Rabbit polyclonal Cytochrome P450 2C8 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 1A2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2. |
Rabbit polyclonal Cytochrome P450 26C1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 26C1. |
UGT1A9 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A9 |
USD 200.00
2 Days
Goat Anti-CYP26B1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SQARSEDKDGRFH, from the internal region of the protein sequence according to NP_063938.1. |
Germany
Japan
United Kingdom
China
