Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal PHAP I Antibody
| Applications | ELISA, ICC, IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PHAP I antibody was raised with a synthetic peptide corresponding to amino acids close to carboxy terminus of human PHAP I. This sequence is identical between human and rat PHAP I. |
Rabbit Polyclonal PHAP I Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PHAP I antibody was raised with a synthetic peptide corresponding to amino acids at carboxy terminus of human PHAP I. |
Rabbit Polyclonal PHAP Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PHAP antibody was raised with a synthetic peptide corresponding to amino acids at carboxy terminus of human PHAP I. |
Rabbit Polyclonal Anti-HMGB1 Antibody
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | HMGB1 antibody was raised against a 19 amino acid peptide near the center of human HMGB1. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal DNMT3B Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using 3 KLH-conjugated synthetic peptides containing sequences from different parts of the protein. |
Rabbit Polyclonal Bak Antibody
| Applications | ELISA, ICC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Bak antibody was raised against a peptide corresponding to 13 amino acids near the amino-terminus of human Bak. |
Rabbit Polyclonal DNMT3B Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNMT3B antibody: mouse DNMT3B (DNA methyltransferase 3B), using a KLH-conjugated synthetic peptide containing a sequence from the N-terminal part of the protein |
Rabbit Polyclonal TRIM28 Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rabbit polyclonal TRIM28 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human TRIM28. |
Active filters
Reactivities
- Human
Applications
- ELISA
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency
Filter by
Category
Target Symbol
- DNMT3B (3)
- PHAP1 (3)
- C-MYB (2)
- C-MYC (2)
- HMG1 (2)
- P53 (2)
- BAK (1)
- BIRC5 (1)
- BUBR1 (1)
- BYSL (1)
- CD30 (1)
- CDC25C (1)
- CRIPTO1 (1)
- CXADR (1)
- CYCLIN A2 (1)
- CYCLIN B2 (1)
- GEMININ (1)
- HDAC2 (1)
- KAP1 (1)
- KU80 (1)
- MCM6 (1)
- MRE11 (1)
- MYH (1)
- NM23A (1)
- NUCLEOPHOSMIN (1)
- OTX2 (1)
- PAK1 (1)
- PCNA (1)
- PIAS2 (1)
- PPAP2C (1)
- PRION PROTEIN PRP (1)
- RFC4 (1)
- SCRAMBLASE 1 (1)
- SFRS3 (1)
- SP1 (1)
- SSB (1)
- TGIF (1)
- TRIP (1)
- XPG (1)
Antibody Hosts
Conjugates
Assay Types
Pathways
- Cell cycle (11)
- Pathways in cancer (7)
- Chronic myeloid leukemia (5)
- Colorectal cancer (5)
- MAPK signaling pathway (5)
- Metabolic pathways (5)
- Small cell lung cancer (5)
- Base excision repair (4)
- Bladder cancer (4)
- Endometrial cancer (4)
- Huntington's disease (4)
- Thyroid cancer (4)
- Wnt signaling pathway (4)
- Cysteine and methionine metabolism (3)
- DNA replication (3)
- ErbB signaling pathway (3)
- Jak-STAT signaling pathway (3)
- Nucleotide excision repair (3)
- Progesterone-mediated oocyte maturation (3)
- TGF-beta signaling pathway (3)
- p53 signaling pathway (3)
- Acute myeloid leukemia (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Apoptosis (2)
- Basal cell carcinoma (2)
- Fc gamma R-mediated phagocytosis (2)
- Glioma (2)
- Melanoma (2)
- Mismatch repair (2)
- Neurotrophin signaling pathway (2)
- Non-homologous end-joining (2)
- Non-small cell lung cancer (2)
- Oocyte meiosis (2)
- Pancreatic cancer (2)
- Prostate cancer (2)
- Axon guidance (1)
- Chemokine signaling pathway (1)
- Cytokine-cytokine receptor interaction (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Ether lipid metabolism (1)
- Focal adhesion (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Homologous recombination (1)
- Natural killer cell mediated cytotoxicity (1)
- Notch signaling pathway (1)
- Prion diseases (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- Regulation of actin cytoskeleton (1)
- Renal cell carcinoma (1)
- Sphingolipid metabolism (1)
- Spliceosome (1)
- Systemic lupus erythematosus (1)
- T cell receptor signaling pathway (1)
- Ubiquitin mediated proteolysis (1)
- Viral myocarditis (1)