Primary Antibodies

View as table Download

Purified P53 (TP53) mouse monoclonal antibody, clone UMAB62

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

GATA3 mouse monoclonal antibody,clone UMAB218

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CD80 mouse monoclonal antibody, clone UMAB65

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NKX3-1 mouse monoclonal antibody,clone UMAB195

Applications 10k-ChIP, IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ERG mouse monoclonal antibody,clone UMAB76

Applications 10k-ChIP, IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FOXP3 mouse monoclonal antibody,clone UMAB248

Applications 10k-ChIP, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ERG mouse monoclonal antibody,clone UMAB76

Applications 10k-ChIP, IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ERG mouse monoclonal antibody,clone UMAB77

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NKX3-1 mouse monoclonal antibody,clone UMAB196

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

P53 (TP53) mouse monoclonal antibody, clone UMAB206

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

CRABP2 mouse monoclonal antibody,clone UMAB176

Applications 10k-ChIP, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-TAF2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH

Rabbit Polyclonal Anti-THRB Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK