Purified P53 (TP53) mouse monoclonal antibody, clone UMAB62
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Purified P53 (TP53) mouse monoclonal antibody, clone UMAB62
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GATA3 mouse monoclonal antibody,clone UMAB218
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD80 mouse monoclonal antibody, clone UMAB65
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NKX3-1 mouse monoclonal antibody,clone UMAB195
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERG mouse monoclonal antibody,clone UMAB76
Applications | 10k-ChIP, IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
FOXP3 mouse monoclonal antibody,clone UMAB248
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERG mouse monoclonal antibody,clone UMAB76
Applications | 10k-ChIP, IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ERG mouse monoclonal antibody,clone UMAB77
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NKX3-1 mouse monoclonal antibody,clone UMAB196
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
P53 (TP53) mouse monoclonal antibody, clone UMAB206
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CRABP2 mouse monoclonal antibody,clone UMAB176
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
NKX3-1 mouse monoclonal antibody,clone UMAB195
Applications | 10k-ChIP, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TAF2 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH |
Rabbit Polyclonal Anti-THRB Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK |