Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CXCR2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CXCR2 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CXCR2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon (100%); Gorilla (94%); Marmoset (88%).

CXCR2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide mapping at the middle region of human CXCR2

Rabbit Polyclonal Anti-CXCR1 (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)SNITDPQMW DFDDLN, corresponding to aminoacid residues 2-16 of human CXCR1. Extracellular, N-terminus.

Rabbit Polyclonal Anti-CXCR2 (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)EDFNMESDSFEDFWKGED, corresponding to amino acid residues 2-19 of human CXCR2 . Extracellular, N-terminus.

Rabbit Polyclonal Anti-CXCR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CXCR1

Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V).
Modifications Phospho-specific

Rabbit Polyclonal IL-8R beta/CDw128 beta (Ser347) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of Serine 347
Modifications Phospho-specific

Rabbit Polyclonal Anti-CXCR2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CXCR2 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CXCR2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Monkey (88%).

Rabbit Polyclonal Anti-IL8RB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF