Primary Antibodies

Jump to Filters
View as table Download
EIF4B pSer422 Rabbit Polyclonal Antibody
AP09472PU-N

USD 405.00

2 Weeks

EIF4B pSer422 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from Human eIF4B around the phosphorylation site of Serine 422 (T-G-Sp-E-S).
EIF4B pSer422 Rabbit Polyclonal Antibody
AP09472PU-S

USD 315.00

2 Weeks

EIF4B pSer422 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from Human eIF4B around the phosphorylation site of Serine 422 (T-G-Sp-E-S).
EIF4B Rabbit Polyclonal Antibody
TA343151

USD 539.00

5 Days

Rabbit Polyclonal Anti-EIF4B Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Eif4b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eif4b. Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV
EIF4B Rabbit Polyclonal Antibody
TA348012

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-eIF4B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-eIF4B Antibody: A synthesized peptide derived from human eIF4B
EIF4B Rabbit Polyclonal Antibody
TA348915

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-eIF4B (Phospho-Ser422) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-eIF4B (Phospho-Ser422) Antibody: A synthesized peptide derived from human eIF4B (Phospho-Ser422)
Modifications Phospho-specific