Primary Antibodies

View as table Download

Rabbit Polyclonal Antibody against Fe65

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant rat protein expressed in bacteria.

Rabbit Polyclonal Anti-TNFRSF1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI

Rabbit Polyclonal anti-ATF6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATF6 antibody: synthetic peptide directed towards the N terminal of human ATF6. Synthetic peptide located within the following region: GYFTDTDELQLEAANETYENNFDNLDFDLDLMPWESDIWDINNQICTVKD

Rabbit anti-APBB1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human APBB1

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS

PPP3CB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PPP3CB

ATF6 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ATF6