CLIC1 (NM_001288) Human Recombinant Protein

CAT#: TP720956

Reviews ()
Write a review

Purified recombinant protein of Human chloride intracellular channel 1 (CLIC1)



  View other "CLIC1" proteins (4)

USD 300.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human chloride intracellular channel 1 (CLIC1)
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MGSSHHHHHHSSGLVPRGSHMAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQ
Tag N-His
Predicted MW 29 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_001279
Locus ID 1192
Refseq Size 1265
Cytogenetics 6p21.33
Refseq ORF 723
Synonyms CL1C1; G6; NCC27
Summary Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Ion Channels: Other

Documents

Other Versions

Other products for "CLIC1"
Frequently bought together (1)
Rabbit Polyclonal Anti-CLIC1 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101