NFYA (NM_021705) Human Recombinant Protein

CAT#: TP720850

Reviews ()
Write a review

Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2



  View other "NFYA" proteins (7)

USD 330.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human nuclear transcription factor Y, alpha (NFYA), transcript variant 2
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSPEFMEQYTANSNSSTEQIVVQAGQIQQQV
Tag N-GST
Predicted MW 60.58 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_068351
Locus ID 4800
UniProt ID P23511, A0A024RD22
Cytogenetics 6p21.1
Refseq Size 6149
Refseq ORF 954
Synonyms CBF-A; CBF-B; HAP2; NF-YA
Summary The protein encoded by this gene is one subunit of a trimeric complex, forming a highly conserved transcription factor that binds to CCAAT motifs in the promoter regions in a variety of genes. Subunit A associates with a tight dimer composed of the B and C subunits, resulting in a trimer that binds to DNA with high specificity and affinity. The sequence specific interactions of the complex are made by the A subunit, suggesting a role as the regulatory subunit. In addition, there is evidence of post-transcriptional regulation in this gene product, either by protein degradation or control of translation. Further regulation is represented by alternative splicing in the glutamine-rich activation domain, with clear tissue-specific preferences for the two isoforms. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Protein Pathways Antigen processing and presentation

Documents

Other Versions

Other products for "NFYA"
Frequently bought together (1)
Rabbit Polyclonal anti-NFYA antibody
    • 100 ul

USD 396.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools
HUMAN PROREINS 101