Psmd5 (NM_080554) Mouse Recombinant Protein

CAT#: TP508111

Purified recombinant protein of Mouse proteasome (prosome, macropain) 26S subunit, non-ATPase, 5 (Psmd5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208111 representing NM_080554
  Red=Cloning site Green=Tags(s)
  
  MAAQAVSLLREVARLEAPLEELRALQSVVQAVPLHELREQAAELRLRPLFSLLNQNNREQTALCVSILER
  LLQAVEPIHLARNLRLDLQRGLTHPDDSVKTLTLSQIGRIVENSEAVTEILNNAELLKQIVYCIGGENLS
  VAKAAIKSLSRISLTQAGLEALFESNLLDDLKNVMKTNDVVRYRVYELIIDISSVSSESLNYCTTSGLVT
  QLLKELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSGFYLPGFVKFFGNL
  AVMDSPQQICERYPVFLEKVFEMADSQDPTMIGVAVDTVGILGSSVEGKQVLQKTGTRFERVLMRVGYQA
  KNASTELKIRCLDAVSSLLYLSPEQQTDDFLGMTESWFSSMSRDSLELFRGISNQPFPELHCAALKVFTA
  IADQPWAQRLMFNSPGFVEFVMDRSVEHDKASKDAKYELVKALANSKTVAEIFGNSNYLRLRAYLSEGPY
  YVKPVATTAVEGAD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 56.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_542121
• Locus ID: 66998
• UniProt ID: Q8BJY1
• Cytogenetics: 2 B
• Refseq Size: 2065
• Refseq ORF: 1512
• Synonyms: 1500032A03Rik; AW475925; mKIAA0072; S5b; W91691
• Summary: Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD5:PSMC2:PSMC1:PSMD2 module which probably assembles with a PSMD10:PSMC4:PSMC5:PAAF1 module followed by dissociation of PSMD5 (By similarity).[UniProtKB/Swiss-Prot Function]