Agpat5 (NM_026792) Mouse Recombinant Protein
CAT#: TP505612
Purified recombinant protein of Mouse 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) (Agpat5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Agpat5"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205612 protein sequence
Red=Cloning site Green=Tags(s) MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPARLYQRVDDRLYCVYQNMVLFFFENYT GVQILLYGDLPKNKENVIYLANHQSTVDWIVADMLAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIY VKRSAKFNDKEMRSKLQSYVNAGTPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKA THVAFDSMKSHLDAIYDVTVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKK WLHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTESGRKLYMGTW LYGTLLGCLWFVIKA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 42.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_081068 |
Locus ID | 52123 |
UniProt ID | Q9D1E8 |
Cytogenetics | 8 10.3 cM |
Refseq Size | 3829 |
Refseq ORF | 1098 |
Synonyms | 1110013A05Rik; D8Ertd319e |
Summary | Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone (PubMed:15367102). Acts on LPA containing saturated or unsaturated fatty acids C15:0-C20:4 at the sn-1 position using C18:1-CoA as the acyl donor (By similarity). Also acts on lysophosphatidylethanolamine using oleoyl-CoA, but not arachidonoyl-CoA, and lysophosphatidylinositol using arachidonoyl-CoA, but not oleoyl-CoA (By similarity). Activity toward lysophosphatidylglycerol not detectable (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.