ABLIM2 (NM_001130088) Human Recombinant Protein
CAT#: TP325796
Recombinant protein of human actin binding LIM protein family, member 2 (ABLIM2), transcript variant 7, 20 µg
View other "ABLIM2" proteins (17)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225796 representing NM_001130088
Red=Cloning site Green=Tags(s) MSAVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYI CTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCSLPVSV GSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLNAEYISKDGLPYCEADYHAKFGI RCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSS ESIISVPASSTSGSPSRVIYAKLGGEILDYRDLAALPKSKAIYDIDRPDMISYSPYISHSAGDRQSYGES PQLLSPTPTEGDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRPAARRSDGEDGSLDQDNRKQK SSWLMLKGDADTRTNSPDLDTQSLSHSSGTDRDPLQRMAGDSFHSREWFF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001123560 |
Locus ID | 84448 |
UniProt ID | Q6H8Q1 |
Cytogenetics | 4p16.1 |
Refseq ORF | 1410 |
Summary | May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410126 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC427151 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427152 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427153 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427154 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427155 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC427156 | ABLIM2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY410126 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 6 |
USD 665.00 |
|
LY427151 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 1 |
USD 436.00 |
|
LY427152 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 2 |
USD 436.00 |
|
LY427153 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 3 |
USD 436.00 |
|
LY427154 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 4 |
USD 436.00 |
|
LY427155 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 5 |
USD 436.00 |
|
LY427156 | Transient overexpression lysate of actin binding LIM protein family, member 2 (ABLIM2), transcript variant 7 |
USD 436.00 |
|
PH325796 | ABLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_001123560) |
USD 3,255.00 |
|
PH326056 | ABLIM2 MS Standard C13 and N15-labeled recombinant protein (NP_001123555) |
USD 3,255.00 |
|
TP326056 | Purified recombinant protein of Homo sapiens actin binding LIM protein family, member 2 (ABLIM2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review