MAD2L2 (NM_001127325) Human Recombinant Protein
CAT#: TP325253
Recombinant protein of human MAD2 mitotic arrest deficient-like 2 (yeast) (MAD2L2), transcript variant 1, 20 µg
View other "MAD2L2" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225253 protein sequence
Red=Cloning site Green=Tags(s) MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHC VKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHN PPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKG S myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001120797 |
Locus ID | 10459 |
UniProt ID | Q9UI95, A0A024R4I4 |
Cytogenetics | 1p36.22 |
Refseq Size | 1196 |
Refseq ORF | 633 |
Synonyms | FANCV; MAD2B; POLZ2; REV7 |
Summary | The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416709 | MAD2L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426747 | MAD2L2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY416709 | Transient overexpression lysate of MAD2 mitotic arrest deficient-like 2 (yeast) (MAD2L2), transcript variant 2 |
USD 436.00 |
|
LY426747 | Transient overexpression lysate of MAD2 mitotic arrest deficient-like 2 (yeast) (MAD2L2), transcript variant 1 |
USD 436.00 |
|
PH325253 | MAD2L2 MS Standard C13 and N15-labeled recombinant protein (NP_001120797) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review