SYCE3 (NM_001123225) Human Recombinant Protein
CAT#: TP325004
Recombinant protein of human chromosome 22 open reading frame 41 (C22orf41), 20 µg
View other "SYCE3" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225004 representing NM_001123225
Red=Cloning site Green=Tags(s) MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK EEMEKNWQELLHETKQRL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001116697 |
Locus ID | 644186 |
UniProt ID | A1L190 |
Cytogenetics | 22q13.33 |
Refseq ORF | 264 |
Synonyms | C22orf41; THEG2 |
Summary | Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426602 | SYCE3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY426602 | Transient overexpression lysate of chromosome 22 open reading frame 41 (C22orf41) |
USD 436.00 |
|
PH325004 | C22orf41 MS Standard C13 and N15-labeled recombinant protein (NP_001116697) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review