SYCE3 (NM_001123225) Human Recombinant Protein

CAT#: TP325004

Recombinant protein of human chromosome 22 open reading frame 41 (C22orf41), 20 µg

Product Images

Coomassie blue staining of purified SYCE3 protein (Cat# TP325004). The protein was produced from HEK293T cells transfected with SYCE3 cDNA clone (Cat# RC225004) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC225004 representing NM_001123225
  Red=Cloning site Green=Tags(s)
  
  MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK
  EEMEKNWQELLHETKQRL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001116697
• Locus ID: 644186
• UniProt ID: A1L190
• Cytogenetics: 22q13.33
• Refseq ORF: 264
• Synonyms: C22orf41; THEG2
• Summary: Major component of the transverse central element of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Required for chromosome loading of the central element-specific SCS proteins, and for initiating synapsis between homologous chromosomes. Chromosome loading appears to require SYCP1. Required for fertility.[UniProtKB/Swiss-Prot Function]