ICEBERG (CARD18) (NM_021571) Human Recombinant Protein

CAT#: TP324896

Recombinant protein of human caspase recruitment domain family, member 18 (CARD18), 20 µg

Product Images

Coomassie blue staining of purified CARD18 protein (Cat# TP324896). The protein was produced from HEK293T cells transfected with CARD18 cDNA clone (Cat# RC224896) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC224896 representing NM_021571
  Red=Cloning site Green=Tags(s)
  
  MADQLLRKKRRIFIHSVGAGTINALLDCLLEDEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCC
  KFIKHLCEEDPQLASKMGLH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067546
• Locus ID: 59082
• UniProt ID: P57730
• Cytogenetics: 11q22.3
• Refseq Size: 431
• Refseq ORF: 270
• Synonyms: ICEBERG; pseudo-ICE; UNQ5804
• Summary: Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome
• Protein Pathways: NOD-like receptor signaling pathway