HOATZ (NM_207430) Human Recombinant Protein
CAT#: TP317907
Recombinant protein of human chromosome 11 open reading frame 88 (C11orf88), transcript variant 1, 20 µg
View other "HOATZ" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217907 representing NM_207430
Red=Cloning site Green=Tags(s) METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDSSQRLPVARPR RSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKTRSHSVTQNEVQWHDHGSLQPQLSRIQ AKTREEILQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_997313 |
Locus ID | 399949 |
UniProt ID | Q6PI97 |
Cytogenetics | 11q23.1 |
Refseq Size | 800 |
Refseq ORF | 588 |
Synonyms | C11orf88 |
Summary | Required for motile ciliogenesis and flagellar genesis by mediating the maturation of the glycolytic enzyme ENO4.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404031 | C11orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420240 | C11orf88 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404031 | Transient overexpression lysate of chromosome 11 open reading frame 88 (C11orf88), transcript variant 1 |
USD 436.00 |
|
LY420240 | Transient overexpression lysate of chromosome 11 open reading frame 88 (C11orf88), transcript variant 2 |
USD 436.00 |
|
PH317907 | C11orf88 MS Standard C13 and N15-labeled recombinant protein (NP_997313) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review