DEFB113 (NM_001037729) Human Recombinant Protein
CAT#: TP316994
Purified recombinant protein of Homo sapiens defensin, beta 113 (DEFB113), 20 µg
View other "DEFB113" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216994 representing NM_001037729
Red=Cloning site Green=Tags(s) MKILCIFLTFVFTVSCGPSVPQKKTREVAERKRECQLVRGACKPECNSWEYVYYYCNVNPCCAVWEYQKP IINKITSKLHQK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 9.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001032818 |
Locus ID | 245927 |
UniProt ID | Q30KQ7 |
Cytogenetics | 6p12.3 |
Refseq Size | 249 |
Refseq ORF | 246 |
Synonyms | DEFB-13 |
Summary | Defensins form a family of antimicrobial and cytotoxic peptides made by neutrophils. Defensins are short, processed peptide molecules that are classified by structure into three groups: alpha-defensins, beta-defensins and theta-defensins. All beta-defensin genes are densely clustered in four to five syntenic chromosomal regions. [provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421980 | DEFB113 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY421980 | Transient overexpression lysate of defensin, beta 113 (DEFB113) |
USD 436.00 |
|
PH316994 | DEFB113 MS Standard C13 and N15-labeled recombinant protein (NP_001032818) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review