COMMD6 (NM_203495) Human Recombinant Protein

CAT#: TP316105

Recombinant protein of human COMM domain containing 6 (COMMD6), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified COMMD6 protein (Cat# TP316105). The protein was produced from HEK293T cells transfected with COMMD6 cDNA clone (Cat# RC216105) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC216105 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQN
  FYRQFKEIAAVIETV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_987091
• Locus ID: 170622
• UniProt ID: Q7Z4G1
• Cytogenetics: 13q22.2
• Refseq Size: 1695
• Refseq ORF: 255
• Synonyms: Acrg
• Summary: COMMD6 belongs to a family of NF-kappa-B (see RELA; MIM 164014)-inhibiting proteins characterized by the presence of a COMM domain (see COMMD1; MIM 607238) (de Bie et al., 2006 [PubMed 16573520]).[supplied by OMIM, Mar 2009]