STK23 (SRPK3) (NM_014370) Human Recombinant Protein
CAT#: TP315496
Recombinant protein of human SFRS protein kinase 3 (SRPK3), 20 µg
View other "STK23" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215496 protein sequence
Red=Cloning site Green=Tags(s) MSASTGGGGDSGGSGGSSSSSQASCGPESSGSELALATPVPQMLQGLLGSDDEEQEDPKDYCKGGYHPVK IGDVFNGRYHVVRKLGWGHFSTVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKR ETIVQLIDDFRISGVNGVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIH TDIKPENILLCVGDAYIRRLAAEATEWQQAGAPPPSRSIVSTAPQEVLQTGKLSKNKRKKMRRKRKQQKR LLEERLRDLQRLEAMEAATQAEDSGLRLDGGSGSTSSSGCHPGGARAGPSPASSSPAPGGGRSLSAGSQT SGFSGSLFSPASCSILSGSSNQRETGGLLSPSTPFGASNLLVNPLEPQNADKIKIKIADLGNACWVHKHF TEDIQTRQYRAVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPP AFALSGRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL QHPWLNP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 61.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | SRPK3 activity verified in a biochemical assay: SRPK3 (SRSF protein kinase 3) (TP315496) activity was measured in a homogeneous time-resolved fluorescent (HTRF®) assay. SRPK3 is a serine/threonine kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. Varying concentrations of SRPK3 were added to a reaction mix containing ATP and a biotinylated kinase substrate and the reaction mixture was incubated to allow the protein to phosphorylate the substrate. HTRF detection reagents were then added, and the time-resolved fluorescent signal was measured on a Flexstation 3 microplate reader. The time resolved fluorescent signal is expressed as “delta R” or “ΔR” and is a ratio calculated from the fluorescent emission intensities of the donor and acceptor fluors. |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055185 |
Locus ID | 26576 |
UniProt ID | Q9UPE1 |
Cytogenetics | Xq28 |
Refseq Size | 2014 |
Refseq ORF | 1701 |
Synonyms | MSSK-1; MSSK1; STK23 |
Summary | This gene encodes a protein kinase similar to a protein kinase which is specific for the SR (serine/arginine-rich domain) family of splicing factors. A highly similar protein has been shown to play a role in muscle development in mice. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2009] |
Protein Families | Druggable Genome, Protein Kinase |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415334 | SRPK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC433283 | SRPK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY415334 | Transient overexpression lysate of SFRS protein kinase 3 (SRPK3), transcript variant 1 |
USD 665.00 |
|
LY433283 | Transient overexpression lysate of SRSF protein kinase 3 (SRPK3), transcript variant 2 |
USD 436.00 |
|
PH315496 | SRPK3 MS Standard C13 and N15-labeled recombinant protein (NP_055185) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review